General Information

  • ID:  hor001220
  • Uniprot ID:  Q18234
  • Protein name:  FLP-21
  • Gene name:  flp-21
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  Expressed in the ADL, ASE and ASH sensory neurons, the URA motor neurons and the MC, M2 and M4 pharyngeal neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0030431 sleep
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GLGPRPLRF
  • Length:  9
  • Propeptide:  MRLFILLSCLLAWVLAAPYIDQEDALRVLNAYLEQFGPGSDRVYYVAEDDHGSMKRGLGPRPLRFG
  • Signal peptide:  MRLFILLSCLLAWVLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamide-like neuropeptide (PubMed:12821653, PubMed:14555955). Involved in modulating locomotion quiescence during the sleep-like state called lethargus which occurs during molting between larval and adult stages, acting via the G-protein coupled receptor npr-1 (PubMed:23764289). Plays a role in modulating social and feeding behavior (PubMed:14555955).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q18234-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001220_AF2.pdbhor001220_ESM.pdb

Physical Information

Mass: 115509 Formula: C47H77N15O10
Absent amino acids: ACDEHIKMNQSTVWY Common amino acids: GLPR
pI: 12.5 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -28.89 Boman Index: -1514
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.67
Instability Index: 4331.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20013198
  • Title:  Approaches to Identify Endogenous Peptides in the Soil Nematode Caenorhabditis elegans